The Customer Controller provides access to your own customer account within the AdmiralCloud platform. It exposes the central configuration of your tenant, allowing you to retrieve and update account-wide settings and platform behavior.
Key Features
- Account Configuration: Manage core settings that define how your AdmiralCloud account operates
- Platform Defaults: Configure default values and behaviors that apply across users, content, and integrations
- Self-Service Updates: Adjust account-level settings without involving AdmiralCloud support
- Read & Update Only: Designed for managing the existing customer account — creation and deletion are handled separately by AdmiralCloud
The Customer Controller acts as the single source of truth for your tenant configuration, ensuring that account-wide changes are applied consistently throughout the platform.
Reference
Customer find
GET/v5/customer/:id
Request Parameters
| Field | Type | Required | Description |
|---|---|---|---|
| field | string | ✗ | Property to filter the result (e.g. contractConfiguration will only return that property) allowed values: internalConfigurationcontractConfigurationindividualConfigurationmediaMetadataConfigurationcontactMetadataConfigurationlicenseMetadataConfiguration |
Response
| Field | Type | Description |
|---|---|---|
| availableMetadataLanguages | array | Available metadata languages Do not use this anymore |
| availablePublicAreaSettings | object | Available publicarea setting Do not use this anymore. Use a dedicated call |
| contactMetadataConfiguration | object | contactMetadataConfiguration for the customer |
| contactRelationTypes | object | TBA Do not use this anymore. |
| contractConfiguration | object | contractConfiguration for the customer |
| └ userLimit | integer | Configuration for maximum number of users allowed in the system |
| └ userCosts | integer | Configuration for user-related costs Deprecated |
| └ adminLimit | integer | Configuration for maximum number of administrators |
| └ assetLimit | integer | Maximum number of assets that can be stored in the system |
| └ assetCosts | float | Configuration for asset-related costs Deprecated |
| └ storageLimit | long | Maximum storage space allowed in bytes |
| └ storageLimitHuman | string | Human-readable representation of storage limits. Can not be sent |
| └ storageCosts | float | Configuration for storage-related costs Deprecated |
| └ trafficLimit | long | Maximum allowed data transfer in bytes |
| └ trafficLimitHuman | string | Human-readable representation of traffic limits |
| └ trafficCosts | float | Cost per unit of data transfer Deprecated |
| └ availableMetadataLanguages | array | Configuration for supported metadata languages allowed values: aaabafaksqamaranhyasavaeayazbabmeubebnbhbibobsbrbgmycacschcezhcucvkwcocrcycsdadedvnldzeleneoeteueefofafjfifrfrfyffkadegdgaglgvelgnguhthahehzhihohrhuhyigisioiiiuieiaidikisitjvjaklknkskakrkkkmkirwkykvkgkokjkulolalvlilnltlblulgmkmhmlmimrmsmkmgmtmnmimsmynanvnrndngnenlnnnbnonyocojoromospafapiplptpsqurmrorornrusgsasiskskslsesmsnsdsostessqscsrsssuswsvtytatttetgtlthbotitotntstktrtwugukuruzvevivocywawoxhyiyozazhzuuni |
| └ detectFaces | object | Face detection settings |
| └ enabled | boolean | Enable/disable face detection feature |
| └ automatic | boolean | Enable/disable automatic face detection |
| └ quota | integer | Credits for this feature per month. If set to -1 unlimited credits are available and will be charged according to the price list. range: -1 to 1000000 |
| └ detectObjects | object | Object detection settings |
| └ enabled | boolean | Enable/disable object detection feature |
| └ automatic | boolean | Enable/disable automatic object detection |
| └ quota | integer | Credits for this feature per month. If set to -1 unlimited credits are available and will be charged according to the price list. range: -1 to 10000000 |
| └ speechRecognition | object | Speech recognition settings |
| └ enabled | boolean | Enable/disable speech recognition feature |
| └ automatic | boolean | Enable/disable automatic speech recognition |
| └ quota | integer | Credits for this feature per month. If set to -1 unlimited credits are available and will be charged according to the price list. range: -1 to 100000 |
| └ awsRekognition | object | Configuration for AWS Rekognition integration Please use generic properties (detectObjects, detectFaces) instead. |
| └ detectLabels | object | Settings for AWS Rekognition label detection |
| └ enabled | boolean | Enable/disable label detection feature |
| └ automatic | boolean | Enable/disable automatic label detection |
| └ limit | integer | Maximum number of labels to detect range: 0 to 100000 |
| └ detectFaces | object | Settings for AWS Rekognition face detection |
| └ enabled | boolean | Enable/disable face detection feature |
| └ automatic | boolean | Enable/disable automatic face detection |
| └ limit | integer | Maximum number of faces to detect range: 0 to 100000 |
| └ collectionId | string | AWS Rekognition face collection identifier |
| └ awsSMS | object | Configuration for AWS SMS messaging service Deprecated |
| └ azure | object | Configuration for Azure services integration Please use generic properties (translate, ocr) instead. |
| └ textTranslation | object | Settings for Azure text translation service |
| └ enabled | boolean | Enable/disable text translation feature |
| └ ocr | object | Settings for Azure OCR service |
| └ enabled | boolean | Enable/disable OCR feature |
| └ minConfidence | integer | Minimum confidence score for OCR results (0-100) range: 0 to 100 |
| └ hardLimits | boolean | If true, strict limits are enforced |
| └ informOnLimits | object | Configuration for limit notification settings Use IAM policies instead |
| └ enabled | boolean | Enable/disable limit notifications |
| └ interval | integer | Interval for limit notifications |
| └ licensedAssetLimit | integer | Configuration for licensed asset quantity restrictions Deprecated |
| └ licensedMediaContainerTypes | array | Configuration for supported licensed media container formats Deprecated |
| └ liveStats | object | Configuration for real-time statistics tracking |
| └ enabled | boolean | Enable/disable liveStats |
| └ maxTemplates | object | Configuration for template quantity limitations |
| └ total | integer | Number of templates allowed per customer" |
| └ retentionPeriod | integer | Configuration for data retention policies Deprecated |
| └ transcoder | object | Configuration for media transcoding service Deprecated |
| └ customJobList | object | Settings for custom transcoding jobs |
| └ enabled | boolean | Enable/disable custom transcoding jobs |
| └ always | boolean | Always use custom job list for transcoding |
| └ environment | string | Environment configuration for transcoding jobs |
| └ useIntExtSetting | object | Configuration for internal/external resource settings Deprecated |
| contractEnds | integer | Unix timestamp of the contract end |
| contractTemplate | integer | TBA Experimental |
| contractTemplateId | integer | Contract Template – TBC Use contractStats.contractTemplateId |
| createdAt | dateTime | Date and time of the creation |
| creator | integer | creator id of the customer |
| customerIdHash | string | Do not use in production any longer! Identifier of the customer Do not use in production! |
| flag | integer | flag of the customer (1 deactivated/locked, 0 active, 99 test account) allowed values: 019899 |
| freshness | integer | Timestamp that shows the time this object has been cached |
| fromCache | boolean | If true, customer object is delivered from cache |
| individualConfiguration | object | individualConfiguration for the customer |
| └ activatedFeatures | array | List of activate features |
| └ acSync | object | TBCL Experimental |
| └ aiFeatures | array | Configuration for AI features like face recognition and clustering |
| └ enabled | boolean | Enable/disable AI features for the customer |
| └ feature | string | Specific AI feature to configure allowed values: aiCaptionstext2vecsimilaritySearchsmartTagsfaceRecognitiontranslationawsTagsspeechRecognition |
| └ featureFlags | object | Additional flags for specific features |
| └ autoLogoutTime | integer | Not used Not used anymore |
| └ search | object | Not used Not used anymore |
| └ features | object | Not used Not used anymore |
| └ faceDetection | object | Face detection settings |
| └ threshold | float | Threshold for similarity. Do not show faces below the threshold. Defaults to 0 range: -1 to 1 |
| └ messageLogs | object | TBCL Experimental |
| └ burnTimecode | object | Configuration for burning timecode into media |
| └ fontcolor | hexColor | Color of the timecode font |
| └ fontsize | integer | Size of the timecode font range: 9 to 244 |
| └ box | integer | Whether to show a box around the timecode allowed values: 01 |
| └ boxcolor | hexColor | Color of the box around the timecode |
| └ boxborderw | integer | Width of the box border |
| └ gravity | string | Position of the timecode on the video allowed values: northsouth |
| └ offset | integer | Offset of the timecode from the edge allowed values: 01 |
| └ contacts | object | Contact settings configuration |
| └ uiLanguage | string | UI language preference for contacts allowed values: deen |
| └ encryptedMetadata | array | List of metadata fields that should be encrypted. Please note, that in this case the metadata is not searchable! |
| └ fourEyesPrinciple | object | Configuration for four-eyes principle validation customer.fourEyesPrinciple admin.customerExtendedSettings |
| └ enabled | boolean | Enable/disable four-eyes principle |
| └ allowedUsers | array | TBA |
| └ deleteAllowed | array | List of userIds who can delete this setting |
| └ houseKeeping | object | System housekeeping configuration |
| └ cleanUpMissingS3 | object | |
| └ enabled | boolean | Enable/disable S3 cleanup |
| └ notesPrefix | string | Prefix for cleanup notes |
| └ imprint | object | Imprint configuration customer.manageImprint admin.customerExtendedSettings |
| └ url | url | URL of the imprint page |
| └ individualAllowed | boolean | Whether individual imprint is allowed |
| └ preferredAudioLanguages | array | List of preferred audio languages allowed values: aaabafaksqamaranhyasavaeayazbabmeubebnbhbibobsbrbgmycacschcezhcucvkwcocrcycsdadedvnldzeleneoeteueefofafjfifrfrfyffkadegdgaglgvelgnguhthahehzhihohrhuhyigisioiiiuieiaidikisitjvjaklknkskakrkkkmkirwkykvkgkokjkulolalvlilnltlblulgmkmhmlmimrmsmkmgmtmnmimsmynanvnrndngnenlnnnbnonyocojoromospafapiplptpsqurmrorornrusgsasiskskslsesmsnsdsostessqscsrsssuswsvtytatttetgtlthbotitotntstktrtwugukuruzvevivocywawoxhyiyozazhzusilent |
| └ preferredCountries | array | List of preferred countries allowed values: afaxaldzasadaoaiagaramawauatazbsbhbdbbbybebzbjbmbtbobqbabwbvbrioumvgbnbgbfbikhcmcacvkycftdclcncxcccokmcgcdckcrhrcucwcyczdkdjdmdoecegsvgqereeetfkfofjfifrgfpftfgagmgedeghgigrglgdgpgugtgggngwgyhthmhnhkhuisinidciiriqieimilitjmjpjejokzkekikwkglalvlblslrlyliltlumomkmgmwmymvmlmtmhmqmrmuytmxfmmdmcmnmemsmamzmmnanrnpnlncnzninengnunfkpmpnoompkpwpspapgpypephpnplptprqaxkrerorurwblshknlcmfpmvcwssmstsasnrsscslsgsxsksisbsozagskrsseslksdsrsjszsechsytwtjtzthtltgtktotttntrtmtctvvauguaaegbusuyuzvuvevnwfehyezmzwaq |
| └ preferredTemplates | object | Template preferences configuration |
| └ dropsite | integer | Preferred template for dropsite |
| └ downloadlink | integer | Preferred template for download links |
| └ pressarea | integer | Preferred template for press area |
| └ animatedPreview | object | |
| └ enabled | boolean | Enable/disable animated preview (format: 82) |
| └ replaceOriginal | object | Settings for original file replacement |
| └ notify | boolean | Whether to notify on replacement |
| └ versions | boolean | Whether to keep versions on replacement |
| └ securityGroups | object | Security group settings |
| └ displaySortOrder | array | Display sort order of security groups |
| └ metadataLanguages | object | TBCL – UI languages |
| └ mediaContainer | object | Mediacontainer configuration |
| └ defaultSettings | object | |
| └ downloadNotAllowed | boolean | Whether downloads are restricted |
| └ downloadOriginalNotAllowed | boolean | Whether original file downloads are restricted |
| └ publicAreaNotAllowed | boolean | Whether public area access is restricted |
| └ embedLinkNotAllowed | boolean | Whether embed links are restricted |
| └ externalAllowed | boolean | Whether external access is allowed |
| └ internalOnly | boolean | Whether access is internal only |
| └ defaultFlag | integer | Default flag for mediacontainers range: 0 to 9 |
| └ prettifyContainerName | boolean | Whether to prettify container names |
| └ showIDinMediaContainerSummary | boolean | Whether to show IDs in container summaries |
| └ releaseManagement | object | |
| └ enabled | boolean | Enable/disable release management |
| └ automaticRelease | boolean | Enable/disable automatic releases. |
| └ userId | integer | User ID for release management |
| └ media | object | Media handling configuration |
| └ useOriginalFileExtension | boolean | Whether to preserve original file extensions |
| └ useOriginalFilenameForDownload | boolean | If true, original filename is used for downloads instead of generated filename |
| └ useIdSuffixForDownload | boolean | If true, ID suffix is used for downloads to avoid name collisions |
| └ jpgAsJPEG | boolean | If true, JPG files are delivered with .jpeg extension |
| └ expires | object | Media expiration settings |
| └ video | object | Video expiration settings |
| └ expiresFactor | integer | Expiration factor for videos range: 1 to 100 |
| └ expires | integer | Default expiration time for videos |
| └ expiresMinimum | integer | Minimum expiration time for videos |
| └ audio | object | Audio expiration settings |
| └ expiresFactor | integer | Expiration factor for audio |
| └ expires | integer | Default expiration time for audio |
| └ expiresMinimum | integer | Minimum expiration time for audio |
| └ image | object | Image expiration settings |
| └ expires | integer | Default expiration time for images |
| └ expiresMinimum | integer | Minimum expiration time for images |
| └ document | object | Document expiration settings |
| └ expires | integer | Default expiration time for documents |
| └ expiresMinimum | integer | Minimum expiration time for documents |
| └ autoRepairMedia | object | Media repair settings |
| └ disabled | boolean | Disable automatic media repair |
| └ playerConfiguration | object | General settings for playerConfiguration |
| └ ignoreAutoGenerate | array | if set, these playerconfigs will not be autoGenerated |
| └ rawImageHandling | object | General settings for playerConfiguration |
| └ separateFiles | boolean | if true RAW/JPEG pairs will remain separate files |
| └ subtitle | object | Subtitle configuration settings |
| └ defaultSubtitleSettingId | integer | Default setting ID for subtitles |
| └ disableHLSsubtitle | boolean | Whether to disable HLS subtitles |
| └ publish | boolean | Whether to automatically publish subtitles extracted from media |
| └ publishName | string | What name to assign to automatically published subtitles extracted from media |
| └ subtypes | array | Configuration for media subtypes Deprecated |
| └ type | string | Type identifier |
| └ subtype | string | Subtype identifier |
| └ i18n | object | Internationalization settings |
| └ de | string | German translation |
| └ en | string | English translation |
| └ tags | object | Tag system configuration |
| └ objectDetection | object | Object detection settings |
| └ enabled | boolean | Enable/disable object detection |
| └ minConfidence | integer | Minimum confidence threshold for detection range: 0 to 100 |
| └ tagFlag | integer | Flag for object detection tags allowed values: 010 |
| └ autoTranslate | boolean | Enable/disable automatic translation |
| └ fontColor | hexColor | Font color for detected objects |
| └ backgroundColor | hexColor | Background color for detected objects |
| └ iptc | object | IPTC metadata settings |
| └ enabled | boolean | Enable/disable IPTC processing |
| └ tagFlag | integer | Flag for IPTC tags allowed values: 010 |
| └ autoTranslate | boolean | Enable/disable automatic translation |
| └ custom | object | Custom tag settings |
| └ autoTranslate | boolean | Enable/disable automatic translation |
| └ restoreDeleted | boolean | Whether to restore deleted tags |
| └ restoreMerged | boolean | Whether to restore merged tags |
| └ tagsonomy | object | Tag taxonomy settings |
| └ enabled | boolean | Enable/disable tag taxonomy |
| └ parentId | integer | Parent ID for taxonomy |
| └ search | object | Tag search settings |
| └ recentlyUsedForCustomer | object | Settings for recently used tags for the customer |
| └ days | integer | Number of days to consider for recently used tags for the customer range: 1 to 30 |
| └ template | object | Template management configuration customer.manageTemplate admin.customerExtendedSettings |
| └ managedTemplates | object | |
| └ enabled | boolean | Enable/disable managed (by AdmiralCloud) templates. Otherwise template endpoint will only deliver custom templates |
| └ transcoder | object | Transcoder configuration |
| └ previewImagePosition | integer | Position for preview image generation |
| └ useFileNameInPublicArea | boolean | Whether to use original filename in public area |
| └ useIdSuffixForDownload | boolean | Whether to append ID suffix to downloaded files Please use individualConfiguration.media.useIdSuffixForDownload instead |
| └ useIPTCkeywordsAsTags | boolean | Whether to use IPTC keywords as tags (Deprecated) Deprecated |
| └ useOriginalFilenameForDownload | boolean | Whether to use original filename for downloads Please use individualConfiguration.media.useOriginalFilenameForDownload instead |
| └ reports | array | Statistic peport configuration settings |
| └ title | string | identifier for report, currently only statistic_mediahub is used |
| └ cols | array | Column settings for reports |
| └ directDownload | object | Direct download configuration |
| └ ids | array | Allowed IDs for direct download |
| └ enabled | boolean | Enable/disable direct download feature |
| └ upload | object | Upload configuration – used in client app, not on backend! |
| └ metadataDefaults | object | Default metadata settings |
| └ ignoreTitle | boolean | Whether to ignore title metadata |
| └ ignoreDescription | boolean | Whether to ignore description metadata |
| └ ignoreTags | boolean | Whether to ignore tag metadata |
| internalConfiguration | object | internalConfiguration for the customer admin.customerSecuritySettings |
| └ providerConfigurations | array | TBA |
| └ provider | string | TBA |
| └ accessKeyId | string | TBA |
| └ cloudfrontKeypairId | string | TBA |
| └ bucket | string | Bucket to use |
| └ region | string | Region to use, defaults to eu-central-1 |
| └ transferAcceleration | boolean | If true, transferAcceleration is active. Please contact support prior to setting this. |
| └ type | string | Type of the provider (upload, export) allowed values: upload |
| └ default | boolean | Make this setting the default one |
| └ useCID | boolean | If true, CID ist used instead of internal ID |
| └ export | object | TBA |
| └ testAccount | boolean | If true, this is a test account |
| └ kms | object | TBA |
| └ enabled | boolean | If true, Metadata encryption is active. Also check individualConfiguration.encryptedFields |
| └ keyId | string | AWS Key to use in KMS encryption/decryption |
| └ clientBaseUrls | array | List of client base URLs |
| └ clientId | string | Client ID for the base URL |
| └ domain | fqdn | Domain to use for this clientId |
| └ errorImages | object | Setting for custom error messages |
| └ enabled | boolean | If true, custom error images are used for media delivery (startNotYet, ended, 404) |
| ipWhiteList | cidr | Allowed IPs for the customer. Access from other IPs will be denied. |
| lastEditor | integer | lastEditor of the customer |
| licenseMetadataConfiguration | object | licenseMetadataConfiguration for the customer |
| └ maxLicensesPerMediaContainer | integer | Maximum number of licenses per media container (range: 1-10) range: 1 to 10 |
| └ myTypesOnly | boolean | When enabled, restricts available license types to user's own types |
| └ types | array | List of available license types (e.g., 'all', 'web', 'print', 'tv', 'radio', 'commercials') |
| └ i18n | object | Internationalization settings for license metadata |
| └ requiredFieldsDefaults | array | Array of default field names that should be required (e.g., 'start', 'types') |
| └ requiredFields | array | Array of field names that must be filled out (e.g., 'start', 'licensor') |
| └ fields | object | Configuration for license metadata form fields |
| └ title | string | Unique identifier for the field |
| └ type | string | Field type (allowed values: 'input', 'textarea', 'select') allowed values: inputtextareaselect |
| └ typeAttr | array | Array of attributes specific to the field type |
| └ labelText | object | Localized label text for the field |
| └ sortOrder | integer | Position of the field in the form |
| └ isRequired | boolean | Indicates if the field is mandatory |
| └ warningStates | object | Configuration for license warning states and their visual representation |
| └ days | integer | TBCL |
| └ status | string | Warning state identifier |
| └ color | string | RGB color value for the warning state (e.g., '143, 205, 32') |
| mediaContainerRelationTypes | array | DEPRECATED Do not use in production! |
| mediaMetadataConfiguration | object | mediaMetadataConfiguration for the customer |
| name | string | name of the customer |
| searchConfiguration | object | searchConfiguration for the customer |
| securityConfiguration | object | securityConfiguration for the customer |
| └ cname | object | Global cname for the customer |
| └ image | fqdn | Global cname for image delivery |
| └ document | fqdn | Global cname for document delivery |
| └ deleteMediaContainerDescription | boolean | If true, a reason for deletion is required and logged. |
| object | Account-wide MFA configuration | |
| └ enabled | boolean | TBCL |
| └ masked | object | TBCL |
| └ enabled | boolean | TBCL |
| TBCL | ||
| └ from | object | TBCL |
| └ address | TBCL | |
| └ name | string | TBCL |
| └ replyTo | object | TBCL |
| └ address | TBCL | |
| └ name | string | TBCL |
| └ malwareProtection | object | Activate malware protection for ingested files |
| └ enabled | boolean | If true, malware protection is activated |
| └ allowSVGScriptTag | boolean | TBCL |
| └ mfa | object | Account-wide MFA configuration |
| └ required | boolean | If true, all users in account must have MFA enabled |
| └ enabled | boolean | If true, MFA is activated |
| serviceConfiguration | object | serviceConfiguration for the customer |
| └ detectLabels | object | Settings regarding label detection |
| └ service | string | Service for label detection allowed values: aws |
| └ enabled | boolean | If true, service is enabled |
| └ automatic | boolean | If true, all new uploaded items are send to label detection |
| └ limit | integer | Maximum number of detections range: 0 to 100000 |
| └ detectFaces | object | Settings regarding face detection |
| └ service | string | Service for face detection allowed values: aws |
| └ enabled | boolean | If true, service is enabled |
| └ automatic | boolean | If true, all new uploaded items are send to face detection |
| └ limit | integer | Maximum number of detections range: 0 to 100000 |
| └ collectionId | string | Id for the collection |
| └ ocr | object | Settings regarding ocr |
| └ service | string | Service for ocr allowed values: azure |
| └ enabled | boolean | If true, service is enabled |
| └ automatic | boolean | If true, all new uploaded items are send to ocr |
| └ minConfidence | integer | Confidence level to activate OCR range: 0 to 100 |
| └ speechRecognition | object | Settings regarding speechRecognition |
| └ service | string | Service for speechRecognition allowed values: aws |
| └ enabled | boolean | If true, service is enabled |
| └ automatic | boolean | If true, all new uploaded items are send to speechRecognition |
| └ limit | integer | Limit for speechRecognition range: 0 to 100000 |
| └ defaultLanguage | string | defaultLanguage for speechRecognition |
| └ translation | object | Settings regarding translation |
| └ service | string | Service for translation allowed values: azuredeepl |
| └ enabled | boolean | If true, service is enabled |
| └ automatic | boolean | If true, all new uploaded items are send to translation |
| └ limit | integer | Limit for translation range: 0 to 100000 |
| updatedAt | dateTime | Date and time of the last update |
Customer update
PUT/v5/customer/:id
Request Parameters
| Field | Type | Required | Description |
|---|---|---|---|
| contactMetadataConfiguration | object | ✗ | contactMetadataConfiguration for the customer |
| contractEnds | integer | ✗ | Unix timestamp of the contract end |
| field | string | ✗ | Return only the given property allowed values: individualConfigurationcontactMetadataConfigurationmediaMetadataConfigurationsecurityConfigurationsearchConfigurationlicenseMetadataConfiguration |
| field | string | ✗ | Reduce response to that field |
| flag | integer | ✗ | flag of the customer (1 deactivated/locked, 0 active, 99 test account) allowed values: 019899 |
| id | integer | ✗ | ID of the customer to update |
| individualConfiguration | object | ✗ | individualConfiguration for the customer |
| └ activatedFeatures | array | ✗ | List of activate features |
| └ acSync | object | ✗ | TBCL Experimental |
| └ aiFeatures | array | ✗ | Configuration for AI features like face recognition and clustering |
| └ enabled | boolean | ✗ | Enable/disable AI features for the customer |
| └ feature | string | ✗ | Specific AI feature to configure allowed values: aiCaptionstext2vecsimilaritySearchsmartTagsfaceRecognitiontranslationawsTagsspeechRecognition |
| └ featureFlags | object | ✗ | Additional flags for specific features |
| └ autoLogoutTime | integer | ✗ | Not used Not used anymore |
| └ search | object | ✗ | Not used Not used anymore |
| └ features | object | ✗ | Not used Not used anymore |
| └ faceDetection | object | ✗ | Face detection settings |
| └ threshold | float | ✗ | Threshold for similarity. Do not show faces below the threshold. Defaults to 0 range: -1 to 1 |
| └ messageLogs | object | ✗ | TBCL Experimental |
| └ burnTimecode | object | ✗ | Configuration for burning timecode into media |
| └ fontcolor | hexColor | ✗ | Color of the timecode font |
| └ fontsize | integer | ✗ | Size of the timecode font range: 9 to 244 |
| └ box | integer | ✗ | Whether to show a box around the timecode allowed values: 01 |
| └ boxcolor | hexColor | ✗ | Color of the box around the timecode |
| └ boxborderw | integer | ✗ | Width of the box border |
| └ gravity | string | ✗ | Position of the timecode on the video allowed values: northsouth |
| └ offset | integer | ✗ | Offset of the timecode from the edge allowed values: 01 |
| └ contacts | object | ✗ | Contact settings configuration |
| └ uiLanguage | string | ✗ | UI language preference for contacts allowed values: deen |
| └ encryptedMetadata | array | ✗ | List of metadata fields that should be encrypted. Please note, that in this case the metadata is not searchable! |
| └ fourEyesPrinciple | object | ✗ | Configuration for four-eyes principle validation customer.fourEyesPrinciple admin.customerExtendedSettings |
| └ enabled | boolean | ✗ | Enable/disable four-eyes principle |
| └ allowedUsers | array | ✗ | TBA |
| └ deleteAllowed | array | ✗ | List of userIds who can delete this setting |
| └ houseKeeping | object | ✗ | System housekeeping configuration |
| └ cleanUpMissingS3 | object | ✗ | |
| └ enabled | boolean | ✗ | Enable/disable S3 cleanup |
| └ notesPrefix | string | ✗ | Prefix for cleanup notes |
| └ imprint | object | ✗ | Imprint configuration customer.manageImprint admin.customerExtendedSettings |
| └ url | url | ✗ | URL of the imprint page |
| └ individualAllowed | boolean | ✗ | Whether individual imprint is allowed |
| └ preferredAudioLanguages | array | ✗ | List of preferred audio languages allowed values: aaabafaksqamaranhyasavaeayazbabmeubebnbhbibobsbrbgmycacschcezhcucvkwcocrcycsdadedvnldzeleneoeteueefofafjfifrfrfyffkadegdgaglgvelgnguhthahehzhihohrhuhyigisioiiiuieiaidikisitjvjaklknkskakrkkkmkirwkykvkgkokjkulolalvlilnltlblulgmkmhmlmimrmsmkmgmtmnmimsmynanvnrndngnenlnnnbnonyocojoromospafapiplptpsqurmrorornrusgsasiskskslsesmsnsdsostessqscsrsssuswsvtytatttetgtlthbotitotntstktrtwugukuruzvevivocywawoxhyiyozazhzusilent |
| └ preferredCountries | array | ✗ | List of preferred countries allowed values: afaxaldzasadaoaiagaramawauatazbsbhbdbbbybebzbjbmbtbobqbabwbvbrioumvgbnbgbfbikhcmcacvkycftdclcncxcccokmcgcdckcrhrcucwcyczdkdjdmdoecegsvgqereeetfkfofjfifrgfpftfgagmgedeghgigrglgdgpgugtgggngwgyhthmhnhkhuisinidciiriqieimilitjmjpjejokzkekikwkglalvlblslrlyliltlumomkmgmwmymvmlmtmhmqmrmuytmxfmmdmcmnmemsmamzmmnanrnpnlncnzninengnunfkpmpnoompkpwpspapgpypephpnplptprqaxkrerorurwblshknlcmfpmvcwssmstsasnrsscslsgsxsksisbsozagskrsseslksdsrsjszsechsytwtjtzthtltgtktotttntrtmtctvvauguaaegbusuyuzvuvevnwfehyezmzwaq |
| └ preferredTemplates | object | ✗ | Template preferences configuration |
| └ dropsite | integer | ✗ | Preferred template for dropsite |
| └ downloadlink | integer | ✗ | Preferred template for download links |
| └ pressarea | integer | ✗ | Preferred template for press area |
| └ animatedPreview | object | ✗ | |
| └ enabled | boolean | ✗ | Enable/disable animated preview (format: 82) |
| └ replaceOriginal | object | ✗ | Settings for original file replacement |
| └ notify | boolean | ✗ | Whether to notify on replacement |
| └ versions | boolean | ✗ | Whether to keep versions on replacement |
| └ securityGroups | object | ✗ | Security group settings |
| └ displaySortOrder | array | ✗ | Display sort order of security groups |
| └ metadataLanguages | object | ✗ | TBCL – UI languages |
| └ mediaContainer | object | ✗ | Mediacontainer configuration |
| └ defaultSettings | object | ✗ | |
| └ downloadNotAllowed | boolean | ✗ | Whether downloads are restricted |
| └ downloadOriginalNotAllowed | boolean | ✗ | Whether original file downloads are restricted |
| └ publicAreaNotAllowed | boolean | ✗ | Whether public area access is restricted |
| └ embedLinkNotAllowed | boolean | ✗ | Whether embed links are restricted |
| └ externalAllowed | boolean | ✗ | Whether external access is allowed |
| └ internalOnly | boolean | ✗ | Whether access is internal only |
| └ defaultFlag | integer | ✗ | Default flag for mediacontainers range: 0 to 9 |
| └ prettifyContainerName | boolean | ✗ | Whether to prettify container names |
| └ showIDinMediaContainerSummary | boolean | ✗ | Whether to show IDs in container summaries |
| └ releaseManagement | object | ✗ | |
| └ enabled | boolean | ✗ | Enable/disable release management |
| └ automaticRelease | boolean | ✗ | Enable/disable automatic releases. |
| └ userId | integer | ✗ | User ID for release management |
| └ media | object | ✗ | Media handling configuration |
| └ useOriginalFileExtension | boolean | ✗ | Whether to preserve original file extensions |
| └ useOriginalFilenameForDownload | boolean | ✗ | If true, original filename is used for downloads instead of generated filename |
| └ useIdSuffixForDownload | boolean | ✗ | If true, ID suffix is used for downloads to avoid name collisions |
| └ jpgAsJPEG | boolean | ✗ | If true, JPG files are delivered with .jpeg extension |
| └ expires | object | ✗ | Media expiration settings |
| └ video | object | ✗ | Video expiration settings |
| └ expiresFactor | integer | ✗ | Expiration factor for videos range: 1 to 100 |
| └ expires | integer | ✗ | Default expiration time for videos |
| └ expiresMinimum | integer | ✗ | Minimum expiration time for videos |
| └ audio | object | ✗ | Audio expiration settings |
| └ expiresFactor | integer | ✗ | Expiration factor for audio |
| └ expires | integer | ✗ | Default expiration time for audio |
| └ expiresMinimum | integer | ✗ | Minimum expiration time for audio |
| └ image | object | ✗ | Image expiration settings |
| └ expires | integer | ✗ | Default expiration time for images |
| └ expiresMinimum | integer | ✗ | Minimum expiration time for images |
| └ document | object | ✗ | Document expiration settings |
| └ expires | integer | ✗ | Default expiration time for documents |
| └ expiresMinimum | integer | ✗ | Minimum expiration time for documents |
| └ autoRepairMedia | object | ✗ | Media repair settings |
| └ disabled | boolean | ✗ | Disable automatic media repair |
| └ playerConfiguration | object | ✗ | General settings for playerConfiguration |
| └ ignoreAutoGenerate | array | ✗ | if set, these playerconfigs will not be autoGenerated |
| └ rawImageHandling | object | ✗ | General settings for playerConfiguration |
| └ separateFiles | boolean | ✗ | if true RAW/JPEG pairs will remain separate files |
| └ subtitle | object | ✗ | Subtitle configuration settings |
| └ defaultSubtitleSettingId | integer | ✗ | Default setting ID for subtitles |
| └ disableHLSsubtitle | boolean | ✗ | Whether to disable HLS subtitles |
| └ publish | boolean | ✗ | Whether to automatically publish subtitles extracted from media |
| └ publishName | string | ✗ | What name to assign to automatically published subtitles extracted from media |
| └ subtypes | array | ✗ | Configuration for media subtypes Deprecated |
| └ type | string | ✗ | Type identifier |
| └ subtype | string | ✗ | Subtype identifier |
| └ i18n | object | ✗ | Internationalization settings |
| └ de | string | ✗ | German translation |
| └ en | string | ✗ | English translation |
| └ tags | object | ✗ | Tag system configuration |
| └ objectDetection | object | ✗ | Object detection settings |
| └ enabled | boolean | ✗ | Enable/disable object detection |
| └ minConfidence | integer | ✗ | Minimum confidence threshold for detection range: 0 to 100 |
| └ tagFlag | integer | ✗ | Flag for object detection tags allowed values: 010 |
| └ autoTranslate | boolean | ✗ | Enable/disable automatic translation |
| └ fontColor | hexColor | ✗ | Font color for detected objects |
| └ backgroundColor | hexColor | ✗ | Background color for detected objects |
| └ iptc | object | ✗ | IPTC metadata settings |
| └ enabled | boolean | ✗ | Enable/disable IPTC processing |
| └ tagFlag | integer | ✗ | Flag for IPTC tags allowed values: 010 |
| └ autoTranslate | boolean | ✗ | Enable/disable automatic translation |
| └ custom | object | ✗ | Custom tag settings |
| └ autoTranslate | boolean | ✗ | Enable/disable automatic translation |
| └ restoreDeleted | boolean | ✗ | Whether to restore deleted tags |
| └ restoreMerged | boolean | ✗ | Whether to restore merged tags |
| └ tagsonomy | object | ✗ | Tag taxonomy settings |
| └ enabled | boolean | ✗ | Enable/disable tag taxonomy |
| └ parentId | integer | ✗ | Parent ID for taxonomy |
| └ search | object | ✗ | Tag search settings |
| └ recentlyUsedForCustomer | object | ✗ | Settings for recently used tags for the customer |
| └ days | integer | ✗ | Number of days to consider for recently used tags for the customer range: 1 to 30 |
| └ template | object | ✗ | Template management configuration customer.manageTemplate admin.customerExtendedSettings |
| └ managedTemplates | object | ✗ | |
| └ enabled | boolean | ✗ | Enable/disable managed (by AdmiralCloud) templates. Otherwise template endpoint will only deliver custom templates |
| └ transcoder | object | ✗ | Transcoder configuration |
| └ previewImagePosition | integer | ✗ | Position for preview image generation |
| └ useFileNameInPublicArea | boolean | ✗ | Whether to use original filename in public area |
| └ useIdSuffixForDownload | boolean | ✗ | Whether to append ID suffix to downloaded files Please use individualConfiguration.media.useIdSuffixForDownload instead |
| └ useIPTCkeywordsAsTags | boolean | ✗ | Whether to use IPTC keywords as tags (Deprecated) Deprecated |
| └ useOriginalFilenameForDownload | boolean | ✗ | Whether to use original filename for downloads Please use individualConfiguration.media.useOriginalFilenameForDownload instead |
| └ reports | array | ✗ | Statistic peport configuration settings |
| └ title | string | ✗ | identifier for report, currently only statistic_mediahub is used |
| └ cols | array | ✗ | Column settings for reports |
| └ directDownload | object | ✗ | Direct download configuration |
| └ ids | array | ✗ | Allowed IDs for direct download |
| └ enabled | boolean | ✗ | Enable/disable direct download feature |
| └ upload | object | ✗ | Upload configuration – used in client app, not on backend! |
| └ metadataDefaults | object | ✗ | Default metadata settings |
| └ ignoreTitle | boolean | ✗ | Whether to ignore title metadata |
| └ ignoreDescription | boolean | ✗ | Whether to ignore description metadata |
| └ ignoreTags | boolean | ✗ | Whether to ignore tag metadata |
| ipWhiteList | cidr | ✗ | Allowed IPs for the customer. Access from other IPs will be denied. |
| licenseMetadataConfiguration | object | ✗ | licenseMetadataConfiguration for the customer |
| └ maxLicensesPerMediaContainer | integer | ✗ | Maximum number of licenses per media container (range: 1-10) range: 1 to 10 |
| └ myTypesOnly | boolean | ✗ | When enabled, restricts available license types to user's own types |
| └ types | array | ✗ | List of available license types (e.g., 'all', 'web', 'print', 'tv', 'radio', 'commercials') |
| └ i18n | object | ✗ | Internationalization settings for license metadata |
| └ requiredFieldsDefaults | array | ✗ | Array of default field names that should be required (e.g., 'start', 'types') |
| └ requiredFields | array | ✗ | Array of field names that must be filled out (e.g., 'start', 'licensor') |
| └ fields | object | ✗ | Configuration for license metadata form fields |
| └ title | string | ✗ | Unique identifier for the field |
| └ type | string | ✗ | Field type (allowed values: 'input', 'textarea', 'select') allowed values: inputtextareaselect |
| └ typeAttr | array | ✗ | Array of attributes specific to the field type |
| └ labelText | object | ✗ | Localized label text for the field |
| └ sortOrder | integer | ✗ | Position of the field in the form |
| └ isRequired | boolean | ✗ | Indicates if the field is mandatory |
| └ warningStates | object | ✗ | Configuration for license warning states and their visual representation |
| └ days | integer | ✗ | TBCL |
| └ status | string | ✗ | Warning state identifier |
| └ color | string | ✗ | RGB color value for the warning state (e.g., '143, 205, 32') |
| mediaMetadataConfiguration | object | ✗ | mediaMetadataConfiguration for the customer |
| name | string | ✗ | name of the customer |
| searchConfiguration | object | ✗ | searchConfiguration for the customer |
| securityConfiguration | object | ✗ | securityConfiguration for the customer |
| └ cname | object | ✗ | Global cname for the customer |
| └ image | fqdn | ✗ | Global cname for image delivery |
| └ document | fqdn | ✗ | Global cname for document delivery |
| └ deleteMediaContainerDescription | boolean | ✗ | If true, a reason for deletion is required and logged. |
| object | ✗ | Account-wide MFA configuration | |
| └ enabled | boolean | ✗ | TBCL |
| └ masked | object | ✗ | TBCL |
| └ enabled | boolean | ✗ | TBCL |
| ✗ | TBCL | ||
| └ from | object | ✗ | TBCL |
| └ address | ✗ | TBCL | |
| └ name | string | ✗ | TBCL |
| └ replyTo | object | ✗ | TBCL |
| └ address | ✗ | TBCL | |
| └ name | string | ✗ | TBCL |
| └ malwareProtection | object | ✗ | Activate malware protection for ingested files |
| └ enabled | boolean | ✗ | If true, malware protection is activated |
| └ allowSVGScriptTag | boolean | ✗ | TBCL |
| └ mfa | object | ✗ | Account-wide MFA configuration |
| └ required | boolean | ✗ | If true, all users in account must have MFA enabled |
| └ enabled | boolean | ✗ | If true, MFA is activated |
| serviceConfiguration | object | ✗ | serviceConfiguration for the customer |
| └ detectLabels | object | ✗ | Settings regarding label detection |
| └ service | string | ✗ | Service for label detection allowed values: aws |
| └ enabled | boolean | ✗ | If true, service is enabled |
| └ automatic | boolean | ✗ | If true, all new uploaded items are send to label detection |
| └ limit | integer | ✗ | Maximum number of detections range: 0 to 100000 |
| └ detectFaces | object | ✗ | Settings regarding face detection |
| └ service | string | ✗ | Service for face detection allowed values: aws |
| └ enabled | boolean | ✗ | If true, service is enabled |
| └ automatic | boolean | ✗ | If true, all new uploaded items are send to face detection |
| └ limit | integer | ✗ | Maximum number of detections range: 0 to 100000 |
| └ collectionId | string | ✗ | Id for the collection |
| └ ocr | object | ✗ | Settings regarding ocr |
| └ service | string | ✗ | Service for ocr allowed values: azure |
| └ enabled | boolean | ✗ | If true, service is enabled |
| └ automatic | boolean | ✗ | If true, all new uploaded items are send to ocr |
| └ minConfidence | integer | ✗ | Confidence level to activate OCR range: 0 to 100 |
| └ speechRecognition | object | ✗ | Settings regarding speechRecognition |
| └ service | string | ✗ | Service for speechRecognition allowed values: aws |
| └ enabled | boolean | ✗ | If true, service is enabled |
| └ automatic | boolean | ✗ | If true, all new uploaded items are send to speechRecognition |
| └ limit | integer | ✗ | Limit for speechRecognition range: 0 to 100000 |
| └ defaultLanguage | string | ✗ | defaultLanguage for speechRecognition |
| └ translation | object | ✗ | Settings regarding translation |
| └ service | string | ✗ | Service for translation allowed values: azuredeepl |
| └ enabled | boolean | ✗ | If true, service is enabled |
| └ automatic | boolean | ✗ | If true, all new uploaded items are send to translation |
| └ limit | integer | ✗ | Limit for translation range: 0 to 100000 |
Response
| Field | Type | Description |
|---|---|---|
| availableMetadataLanguages | array | Available metadata languages Do not use this anymore |
| availablePublicAreaSettings | object | Available publicarea setting Do not use this anymore. Use a dedicated call |
| contactMetadataConfiguration | object | contactMetadataConfiguration for the customer |
| contactRelationTypes | object | TBA Do not use this anymore. |
| contractConfiguration | object | contractConfiguration for the customer |
| └ userLimit | integer | Configuration for maximum number of users allowed in the system |
| └ userCosts | integer | Configuration for user-related costs Deprecated |
| └ adminLimit | integer | Configuration for maximum number of administrators |
| └ assetLimit | integer | Maximum number of assets that can be stored in the system |
| └ assetCosts | float | Configuration for asset-related costs Deprecated |
| └ storageLimit | long | Maximum storage space allowed in bytes |
| └ storageLimitHuman | string | Human-readable representation of storage limits. Can not be sent |
| └ storageCosts | float | Configuration for storage-related costs Deprecated |
| └ trafficLimit | long | Maximum allowed data transfer in bytes |
| └ trafficLimitHuman | string | Human-readable representation of traffic limits |
| └ trafficCosts | float | Cost per unit of data transfer Deprecated |
| └ availableMetadataLanguages | array | Configuration for supported metadata languages allowed values: aaabafaksqamaranhyasavaeayazbabmeubebnbhbibobsbrbgmycacschcezhcucvkwcocrcycsdadedvnldzeleneoeteueefofafjfifrfrfyffkadegdgaglgvelgnguhthahehzhihohrhuhyigisioiiiuieiaidikisitjvjaklknkskakrkkkmkirwkykvkgkokjkulolalvlilnltlblulgmkmhmlmimrmsmkmgmtmnmimsmynanvnrndngnenlnnnbnonyocojoromospafapiplptpsqurmrorornrusgsasiskskslsesmsnsdsostessqscsrsssuswsvtytatttetgtlthbotitotntstktrtwugukuruzvevivocywawoxhyiyozazhzuuni |
| └ detectFaces | object | Face detection settings |
| └ enabled | boolean | Enable/disable face detection feature |
| └ automatic | boolean | Enable/disable automatic face detection |
| └ quota | integer | Credits for this feature per month. If set to -1 unlimited credits are available and will be charged according to the price list. range: -1 to 1000000 |
| └ detectObjects | object | Object detection settings |
| └ enabled | boolean | Enable/disable object detection feature |
| └ automatic | boolean | Enable/disable automatic object detection |
| └ quota | integer | Credits for this feature per month. If set to -1 unlimited credits are available and will be charged according to the price list. range: -1 to 10000000 |
| └ speechRecognition | object | Speech recognition settings |
| └ enabled | boolean | Enable/disable speech recognition feature |
| └ automatic | boolean | Enable/disable automatic speech recognition |
| └ quota | integer | Credits for this feature per month. If set to -1 unlimited credits are available and will be charged according to the price list. range: -1 to 100000 |
| └ awsRekognition | object | Configuration for AWS Rekognition integration Please use generic properties (detectObjects, detectFaces) instead. |
| └ detectLabels | object | Settings for AWS Rekognition label detection |
| └ enabled | boolean | Enable/disable label detection feature |
| └ automatic | boolean | Enable/disable automatic label detection |
| └ limit | integer | Maximum number of labels to detect range: 0 to 100000 |
| └ detectFaces | object | Settings for AWS Rekognition face detection |
| └ enabled | boolean | Enable/disable face detection feature |
| └ automatic | boolean | Enable/disable automatic face detection |
| └ limit | integer | Maximum number of faces to detect range: 0 to 100000 |
| └ collectionId | string | AWS Rekognition face collection identifier |
| └ awsSMS | object | Configuration for AWS SMS messaging service Deprecated |
| └ azure | object | Configuration for Azure services integration Please use generic properties (translate, ocr) instead. |
| └ textTranslation | object | Settings for Azure text translation service |
| └ enabled | boolean | Enable/disable text translation feature |
| └ ocr | object | Settings for Azure OCR service |
| └ enabled | boolean | Enable/disable OCR feature |
| └ minConfidence | integer | Minimum confidence score for OCR results (0-100) range: 0 to 100 |
| └ hardLimits | boolean | If true, strict limits are enforced |
| └ informOnLimits | object | Configuration for limit notification settings Use IAM policies instead |
| └ enabled | boolean | Enable/disable limit notifications |
| └ interval | integer | Interval for limit notifications |
| └ licensedAssetLimit | integer | Configuration for licensed asset quantity restrictions Deprecated |
| └ licensedMediaContainerTypes | array | Configuration for supported licensed media container formats Deprecated |
| └ liveStats | object | Configuration for real-time statistics tracking |
| └ enabled | boolean | Enable/disable liveStats |
| └ maxTemplates | object | Configuration for template quantity limitations |
| └ total | integer | Number of templates allowed per customer" |
| └ retentionPeriod | integer | Configuration for data retention policies Deprecated |
| └ transcoder | object | Configuration for media transcoding service Deprecated |
| └ customJobList | object | Settings for custom transcoding jobs |
| └ enabled | boolean | Enable/disable custom transcoding jobs |
| └ always | boolean | Always use custom job list for transcoding |
| └ environment | string | Environment configuration for transcoding jobs |
| └ useIntExtSetting | object | Configuration for internal/external resource settings Deprecated |
| contractEnds | integer | Unix timestamp of the contract end |
| contractTemplate | integer | TBA Experimental |
| contractTemplateId | integer | Contract Template – TBC Use contractStats.contractTemplateId |
| createdAt | dateTime | Date and time of the creation |
| creator | integer | creator id of the customer |
| customerIdHash | string | Do not use in production any longer! Identifier of the customer Do not use in production! |
| flag | integer | flag of the customer (1 deactivated/locked, 0 active, 99 test account) allowed values: 019899 |
| freshness | integer | Timestamp that shows the time this object has been cached |
| fromCache | boolean | If true, customer object is delivered from cache |
| individualConfiguration | object | individualConfiguration for the customer |
| └ activatedFeatures | array | List of activate features |
| └ acSync | object | TBCL Experimental |
| └ aiFeatures | array | Configuration for AI features like face recognition and clustering |
| └ enabled | boolean | Enable/disable AI features for the customer |
| └ feature | string | Specific AI feature to configure allowed values: aiCaptionstext2vecsimilaritySearchsmartTagsfaceRecognitiontranslationawsTagsspeechRecognition |
| └ featureFlags | object | Additional flags for specific features |
| └ autoLogoutTime | integer | Not used Not used anymore |
| └ search | object | Not used Not used anymore |
| └ features | object | Not used Not used anymore |
| └ faceDetection | object | Face detection settings |
| └ threshold | float | Threshold for similarity. Do not show faces below the threshold. Defaults to 0 range: -1 to 1 |
| └ messageLogs | object | TBCL Experimental |
| └ burnTimecode | object | Configuration for burning timecode into media |
| └ fontcolor | hexColor | Color of the timecode font |
| └ fontsize | integer | Size of the timecode font range: 9 to 244 |
| └ box | integer | Whether to show a box around the timecode allowed values: 01 |
| └ boxcolor | hexColor | Color of the box around the timecode |
| └ boxborderw | integer | Width of the box border |
| └ gravity | string | Position of the timecode on the video allowed values: northsouth |
| └ offset | integer | Offset of the timecode from the edge allowed values: 01 |
| └ contacts | object | Contact settings configuration |
| └ uiLanguage | string | UI language preference for contacts allowed values: deen |
| └ encryptedMetadata | array | List of metadata fields that should be encrypted. Please note, that in this case the metadata is not searchable! |
| └ fourEyesPrinciple | object | Configuration for four-eyes principle validation customer.fourEyesPrinciple admin.customerExtendedSettings |
| └ enabled | boolean | Enable/disable four-eyes principle |
| └ allowedUsers | array | TBA |
| └ deleteAllowed | array | List of userIds who can delete this setting |
| └ houseKeeping | object | System housekeeping configuration |
| └ cleanUpMissingS3 | object | |
| └ enabled | boolean | Enable/disable S3 cleanup |
| └ notesPrefix | string | Prefix for cleanup notes |
| └ imprint | object | Imprint configuration customer.manageImprint admin.customerExtendedSettings |
| └ url | url | URL of the imprint page |
| └ individualAllowed | boolean | Whether individual imprint is allowed |
| └ preferredAudioLanguages | array | List of preferred audio languages allowed values: aaabafaksqamaranhyasavaeayazbabmeubebnbhbibobsbrbgmycacschcezhcucvkwcocrcycsdadedvnldzeleneoeteueefofafjfifrfrfyffkadegdgaglgvelgnguhthahehzhihohrhuhyigisioiiiuieiaidikisitjvjaklknkskakrkkkmkirwkykvkgkokjkulolalvlilnltlblulgmkmhmlmimrmsmkmgmtmnmimsmynanvnrndngnenlnnnbnonyocojoromospafapiplptpsqurmrorornrusgsasiskskslsesmsnsdsostessqscsrsssuswsvtytatttetgtlthbotitotntstktrtwugukuruzvevivocywawoxhyiyozazhzusilent |
| └ preferredCountries | array | List of preferred countries allowed values: afaxaldzasadaoaiagaramawauatazbsbhbdbbbybebzbjbmbtbobqbabwbvbrioumvgbnbgbfbikhcmcacvkycftdclcncxcccokmcgcdckcrhrcucwcyczdkdjdmdoecegsvgqereeetfkfofjfifrgfpftfgagmgedeghgigrglgdgpgugtgggngwgyhthmhnhkhuisinidciiriqieimilitjmjpjejokzkekikwkglalvlblslrlyliltlumomkmgmwmymvmlmtmhmqmrmuytmxfmmdmcmnmemsmamzmmnanrnpnlncnzninengnunfkpmpnoompkpwpspapgpypephpnplptprqaxkrerorurwblshknlcmfpmvcwssmstsasnrsscslsgsxsksisbsozagskrsseslksdsrsjszsechsytwtjtzthtltgtktotttntrtmtctvvauguaaegbusuyuzvuvevnwfehyezmzwaq |
| └ preferredTemplates | object | Template preferences configuration |
| └ dropsite | integer | Preferred template for dropsite |
| └ downloadlink | integer | Preferred template for download links |
| └ pressarea | integer | Preferred template for press area |
| └ animatedPreview | object | |
| └ enabled | boolean | Enable/disable animated preview (format: 82) |
| └ replaceOriginal | object | Settings for original file replacement |
| └ notify | boolean | Whether to notify on replacement |
| └ versions | boolean | Whether to keep versions on replacement |
| └ securityGroups | object | Security group settings |
| └ displaySortOrder | array | Display sort order of security groups |
| └ metadataLanguages | object | TBCL – UI languages |
| └ mediaContainer | object | Mediacontainer configuration |
| └ defaultSettings | object | |
| └ downloadNotAllowed | boolean | Whether downloads are restricted |
| └ downloadOriginalNotAllowed | boolean | Whether original file downloads are restricted |
| └ publicAreaNotAllowed | boolean | Whether public area access is restricted |
| └ embedLinkNotAllowed | boolean | Whether embed links are restricted |
| └ externalAllowed | boolean | Whether external access is allowed |
| └ internalOnly | boolean | Whether access is internal only |
| └ defaultFlag | integer | Default flag for mediacontainers range: 0 to 9 |
| └ prettifyContainerName | boolean | Whether to prettify container names |
| └ showIDinMediaContainerSummary | boolean | Whether to show IDs in container summaries |
| └ releaseManagement | object | |
| └ enabled | boolean | Enable/disable release management |
| └ automaticRelease | boolean | Enable/disable automatic releases. |
| └ userId | integer | User ID for release management |
| └ media | object | Media handling configuration |
| └ useOriginalFileExtension | boolean | Whether to preserve original file extensions |
| └ useOriginalFilenameForDownload | boolean | If true, original filename is used for downloads instead of generated filename |
| └ useIdSuffixForDownload | boolean | If true, ID suffix is used for downloads to avoid name collisions |
| └ jpgAsJPEG | boolean | If true, JPG files are delivered with .jpeg extension |
| └ expires | object | Media expiration settings |
| └ video | object | Video expiration settings |
| └ expiresFactor | integer | Expiration factor for videos range: 1 to 100 |
| └ expires | integer | Default expiration time for videos |
| └ expiresMinimum | integer | Minimum expiration time for videos |
| └ audio | object | Audio expiration settings |
| └ expiresFactor | integer | Expiration factor for audio |
| └ expires | integer | Default expiration time for audio |
| └ expiresMinimum | integer | Minimum expiration time for audio |
| └ image | object | Image expiration settings |
| └ expires | integer | Default expiration time for images |
| └ expiresMinimum | integer | Minimum expiration time for images |
| └ document | object | Document expiration settings |
| └ expires | integer | Default expiration time for documents |
| └ expiresMinimum | integer | Minimum expiration time for documents |
| └ autoRepairMedia | object | Media repair settings |
| └ disabled | boolean | Disable automatic media repair |
| └ playerConfiguration | object | General settings for playerConfiguration |
| └ ignoreAutoGenerate | array | if set, these playerconfigs will not be autoGenerated |
| └ rawImageHandling | object | General settings for playerConfiguration |
| └ separateFiles | boolean | if true RAW/JPEG pairs will remain separate files |
| └ subtitle | object | Subtitle configuration settings |
| └ defaultSubtitleSettingId | integer | Default setting ID for subtitles |
| └ disableHLSsubtitle | boolean | Whether to disable HLS subtitles |
| └ publish | boolean | Whether to automatically publish subtitles extracted from media |
| └ publishName | string | What name to assign to automatically published subtitles extracted from media |
| └ subtypes | array | Configuration for media subtypes Deprecated |
| └ type | string | Type identifier |
| └ subtype | string | Subtype identifier |
| └ i18n | object | Internationalization settings |
| └ de | string | German translation |
| └ en | string | English translation |
| └ tags | object | Tag system configuration |
| └ objectDetection | object | Object detection settings |
| └ enabled | boolean | Enable/disable object detection |
| └ minConfidence | integer | Minimum confidence threshold for detection range: 0 to 100 |
| └ tagFlag | integer | Flag for object detection tags allowed values: 010 |
| └ autoTranslate | boolean | Enable/disable automatic translation |
| └ fontColor | hexColor | Font color for detected objects |
| └ backgroundColor | hexColor | Background color for detected objects |
| └ iptc | object | IPTC metadata settings |
| └ enabled | boolean | Enable/disable IPTC processing |
| └ tagFlag | integer | Flag for IPTC tags allowed values: 010 |
| └ autoTranslate | boolean | Enable/disable automatic translation |
| └ custom | object | Custom tag settings |
| └ autoTranslate | boolean | Enable/disable automatic translation |
| └ restoreDeleted | boolean | Whether to restore deleted tags |
| └ restoreMerged | boolean | Whether to restore merged tags |
| └ tagsonomy | object | Tag taxonomy settings |
| └ enabled | boolean | Enable/disable tag taxonomy |
| └ parentId | integer | Parent ID for taxonomy |
| └ search | object | Tag search settings |
| └ recentlyUsedForCustomer | object | Settings for recently used tags for the customer |
| └ days | integer | Number of days to consider for recently used tags for the customer range: 1 to 30 |
| └ template | object | Template management configuration customer.manageTemplate admin.customerExtendedSettings |
| └ managedTemplates | object | |
| └ enabled | boolean | Enable/disable managed (by AdmiralCloud) templates. Otherwise template endpoint will only deliver custom templates |
| └ transcoder | object | Transcoder configuration |
| └ previewImagePosition | integer | Position for preview image generation |
| └ useFileNameInPublicArea | boolean | Whether to use original filename in public area |
| └ useIdSuffixForDownload | boolean | Whether to append ID suffix to downloaded files Please use individualConfiguration.media.useIdSuffixForDownload instead |
| └ useIPTCkeywordsAsTags | boolean | Whether to use IPTC keywords as tags (Deprecated) Deprecated |
| └ useOriginalFilenameForDownload | boolean | Whether to use original filename for downloads Please use individualConfiguration.media.useOriginalFilenameForDownload instead |
| └ reports | array | Statistic peport configuration settings |
| └ title | string | identifier for report, currently only statistic_mediahub is used |
| └ cols | array | Column settings for reports |
| └ directDownload | object | Direct download configuration |
| └ ids | array | Allowed IDs for direct download |
| └ enabled | boolean | Enable/disable direct download feature |
| └ upload | object | Upload configuration – used in client app, not on backend! |
| └ metadataDefaults | object | Default metadata settings |
| └ ignoreTitle | boolean | Whether to ignore title metadata |
| └ ignoreDescription | boolean | Whether to ignore description metadata |
| └ ignoreTags | boolean | Whether to ignore tag metadata |
| internalConfiguration | object | internalConfiguration for the customer admin.customerSecuritySettings |
| └ providerConfigurations | array | TBA |
| └ provider | string | TBA |
| └ accessKeyId | string | TBA |
| └ cloudfrontKeypairId | string | TBA |
| └ bucket | string | Bucket to use |
| └ region | string | Region to use, defaults to eu-central-1 |
| └ transferAcceleration | boolean | If true, transferAcceleration is active. Please contact support prior to setting this. |
| └ type | string | Type of the provider (upload, export) allowed values: upload |
| └ default | boolean | Make this setting the default one |
| └ useCID | boolean | If true, CID ist used instead of internal ID |
| └ export | object | TBA |
| └ testAccount | boolean | If true, this is a test account |
| └ kms | object | TBA |
| └ enabled | boolean | If true, Metadata encryption is active. Also check individualConfiguration.encryptedFields |
| └ keyId | string | AWS Key to use in KMS encryption/decryption |
| └ clientBaseUrls | array | List of client base URLs |
| └ clientId | string | Client ID for the base URL |
| └ domain | fqdn | Domain to use for this clientId |
| └ errorImages | object | Setting for custom error messages |
| └ enabled | boolean | If true, custom error images are used for media delivery (startNotYet, ended, 404) |
| ipWhiteList | cidr | Allowed IPs for the customer. Access from other IPs will be denied. |
| lastEditor | integer | lastEditor of the customer |
| licenseMetadataConfiguration | object | licenseMetadataConfiguration for the customer |
| └ maxLicensesPerMediaContainer | integer | Maximum number of licenses per media container (range: 1-10) range: 1 to 10 |
| └ myTypesOnly | boolean | When enabled, restricts available license types to user's own types |
| └ types | array | List of available license types (e.g., 'all', 'web', 'print', 'tv', 'radio', 'commercials') |
| └ i18n | object | Internationalization settings for license metadata |
| └ requiredFieldsDefaults | array | Array of default field names that should be required (e.g., 'start', 'types') |
| └ requiredFields | array | Array of field names that must be filled out (e.g., 'start', 'licensor') |
| └ fields | object | Configuration for license metadata form fields |
| └ title | string | Unique identifier for the field |
| └ type | string | Field type (allowed values: 'input', 'textarea', 'select') allowed values: inputtextareaselect |
| └ typeAttr | array | Array of attributes specific to the field type |
| └ labelText | object | Localized label text for the field |
| └ sortOrder | integer | Position of the field in the form |
| └ isRequired | boolean | Indicates if the field is mandatory |
| └ warningStates | object | Configuration for license warning states and their visual representation |
| └ days | integer | TBCL |
| └ status | string | Warning state identifier |
| └ color | string | RGB color value for the warning state (e.g., '143, 205, 32') |
| mediaContainerRelationTypes | array | DEPRECATED Do not use in production! |
| mediaMetadataConfiguration | object | mediaMetadataConfiguration for the customer |
| name | string | name of the customer |
| searchConfiguration | object | searchConfiguration for the customer |
| securityConfiguration | object | securityConfiguration for the customer |
| └ cname | object | Global cname for the customer |
| └ image | fqdn | Global cname for image delivery |
| └ document | fqdn | Global cname for document delivery |
| └ deleteMediaContainerDescription | boolean | If true, a reason for deletion is required and logged. |
| object | Account-wide MFA configuration | |
| └ enabled | boolean | TBCL |
| └ masked | object | TBCL |
| └ enabled | boolean | TBCL |
| TBCL | ||
| └ from | object | TBCL |
| └ address | TBCL | |
| └ name | string | TBCL |
| └ replyTo | object | TBCL |
| └ address | TBCL | |
| └ name | string | TBCL |
| └ malwareProtection | object | Activate malware protection for ingested files |
| └ enabled | boolean | If true, malware protection is activated |
| └ allowSVGScriptTag | boolean | TBCL |
| └ mfa | object | Account-wide MFA configuration |
| └ required | boolean | If true, all users in account must have MFA enabled |
| └ enabled | boolean | If true, MFA is activated |
| serviceConfiguration | object | serviceConfiguration for the customer |
| └ detectLabels | object | Settings regarding label detection |
| └ service | string | Service for label detection allowed values: aws |
| └ enabled | boolean | If true, service is enabled |
| └ automatic | boolean | If true, all new uploaded items are send to label detection |
| └ limit | integer | Maximum number of detections range: 0 to 100000 |
| └ detectFaces | object | Settings regarding face detection |
| └ service | string | Service for face detection allowed values: aws |
| └ enabled | boolean | If true, service is enabled |
| └ automatic | boolean | If true, all new uploaded items are send to face detection |
| └ limit | integer | Maximum number of detections range: 0 to 100000 |
| └ collectionId | string | Id for the collection |
| └ ocr | object | Settings regarding ocr |
| └ service | string | Service for ocr allowed values: azure |
| └ enabled | boolean | If true, service is enabled |
| └ automatic | boolean | If true, all new uploaded items are send to ocr |
| └ minConfidence | integer | Confidence level to activate OCR range: 0 to 100 |
| └ speechRecognition | object | Settings regarding speechRecognition |
| └ service | string | Service for speechRecognition allowed values: aws |
| └ enabled | boolean | If true, service is enabled |
| └ automatic | boolean | If true, all new uploaded items are send to speechRecognition |
| └ limit | integer | Limit for speechRecognition range: 0 to 100000 |
| └ defaultLanguage | string | defaultLanguage for speechRecognition |
| └ translation | object | Settings regarding translation |
| └ service | string | Service for translation allowed values: azuredeepl |
| └ enabled | boolean | If true, service is enabled |
| └ automatic | boolean | If true, all new uploaded items are send to translation |
| └ limit | integer | Limit for translation range: 0 to 100000 |
| updatedAt | dateTime | Date and time of the last update |